Structure of PDB 4yg4 Chain A Binding Site BS02

Receptor Information
>4yg4 Chain A (length=69) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTT
LTTFFKILQSLELSMTLCD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yg4 HipBA-promoter structures reveal the basis of heritable multidrug tolerance.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R21 T27 Q28 Q39 A40 S43
Binding residue
(residue number reindexed from 1)		R18 T24 Q25 Q36 A37 S40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4yg4, PDBe:4yg4, PDBj:4yg4
PDBsum4yg4
PubMed26222023
UniProtP23873|HIPB_ECOLI Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]