Structure of PDB 4xxe Chain A Binding Site BS02

Receptor Information
>4xxe Chain A (length=99) Species: 93062 (Staphylococcus aureus subsp. aureus COL) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKEL
SQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xxe Conformational features of theStaphylococcus aureusAgrA-promoter interactions rationalize quorum-sensing triggered gene expression.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G148 H169 R170 Y183 H200 N201 S231 V232 R233
Binding residue
(residue number reindexed from 1)		G9 H30 R31 Y44 H61 N62 S92 V93 R94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0003677 DNA binding

View graph for
Molecular Function
External links
PDB RCSB:4xxe, PDBe:4xxe, PDBj:4xxe
PDBsum4xxe
PubMed28955870
UniProtQ5HEG2|AGRA_STAAC Accessory gene regulator A (Gene Name=agrA)

[Back to BioLiP]