Structure of PDB 4xrm Chain A Binding Site BS02

Receptor Information
>4xrm Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINAR
RRIVQPMID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xrm DNA-dependent formation of transcription factor pairs alters their binding specificity.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
F279 Q318 N325 R329
Binding residue
(residue number reindexed from 1)
F2 Q41 N48 R52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4xrm, PDBe:4xrm, PDBj:4xrm
PDBsum4xrm
PubMed26550823
UniProtO14770|MEIS2_HUMAN Homeobox protein Meis2 (Gene Name=MEIS2)

[Back to BioLiP]