Structure of PDB 4xr2 Chain A Binding Site BS02

Receptor Information
>4xr2 Chain A (length=305) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLN
RIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDN
LSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVARHLPGLITLN
AYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWT
REEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHA
CPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLH
LYVAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xr2 Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		K89 A90 A91 R93 R157 T158 K175 S193 W208 R232 Q252 Y289 R302
Binding residue
(residue number reindexed from 1)		K85 A86 A87 R89 R153 T154 K171 S189 W204 R228 Q248 Y285 R298
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006274 DNA replication termination
GO:0071807 replication fork arrest involved in DNA replication termination
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xr2, PDBe:4xr2, PDBj:4xr2
PDBsum4xr2
PubMed26322585
UniProtP16525|TUS_ECOLI DNA replication terminus site-binding protein (Gene Name=tus)

[Back to BioLiP]