Structure of PDB 4xr0 Chain A Binding Site BS02

Receptor Information
>4xr0 Chain A (length=308) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARYDLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHN
PLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQ
VDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLI
TLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVA
PWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQV
QHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIP
RLHLYVAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xr0 Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H50 K89 A90 A91 R93 R157 T158 K175 S193 P197 R232 Q237 Q252 P256 Y289 R302
Binding residue
(residue number reindexed from 1)		H49 K88 A89 A90 R92 R156 T157 K174 S192 P196 R231 Q236 Q251 P255 Y288 R301
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006274 DNA replication termination
GO:0071807 replication fork arrest involved in DNA replication termination
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xr0, PDBe:4xr0, PDBj:4xr0
PDBsum4xr0
PubMed26322585
UniProtP16525|TUS_ECOLI DNA replication terminus site-binding protein (Gene Name=tus)

[Back to BioLiP]