Structure of PDB 4x9j Chain A Binding Site BS02

Receptor Information
>4x9j Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLT
THIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x9j Structural impact of complete CpG methylation within target DNA on specific complex formation of the inducible transcription factor Egr-1.
Resolution1.412 Å
Binding residue
(original residue number in PDB)		D120 D148 K179
Binding residue
(residue number reindexed from 1)		D19 D47 K78
Binding affinityPDBbind-CN: Kd=10nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4x9j, PDBe:4x9j, PDBj:4x9j
PDBsum4x9j
PubMed25999311
UniProtP18146|EGR1_HUMAN Early growth response protein 1 (Gene Name=EGR1)

[Back to BioLiP]