Structure of PDB 4x23 Chain A Binding Site BS02

Receptor Information
>4x23 Chain A (length=95) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGIE
Ligand information
>4x23 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x23 A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83
Binding residue
(residue number reindexed from 1)		Y2 G5 V7 A8 R10 R24 K25 L26 P27 R30 R44
Binding affinityPDBbind-CN: Kd=0.1uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4x23, PDBe:4x23, PDBj:4x23
PDBsum4x23
PubMed23723239
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]