Structure of PDB 4wul Chain A Binding Site BS02

Receptor Information
>4wul Chain A (length=65) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLDVD
NRTQAAIYAFQHGLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wul A variable DNA recognition site organization establishes the LiaR-mediated cell envelope stress response of enterococci to daptomycin.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T146 R148 I171 T172 K174 T175 T178 H179
Binding residue
(residue number reindexed from 1)		T6 R8 I31 T32 K34 T35 T38 H39
Binding affinityPDBbind-CN: Kd=21.9uM
External links