Structure of PDB 4uuv Chain A Binding Site BS02

Receptor Information
>4uuv Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRP
AMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPDALFSMAFPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uuv Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Q342 L343 W381 K385 R387 D393 K394 S398 Y401 Y402
Binding residue
(residue number reindexed from 1)		Q4 L5 W43 K47 R49 D55 K56 S60 Y63 Y64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4uuv, PDBe:4uuv, PDBj:4uuv
PDBsum4uuv
PubMed25866208
UniProtP43268|ETV4_HUMAN ETS translocation variant 4 (Gene Name=ETV4)

[Back to BioLiP]