Structure of PDB 4tzd Chain A Binding Site BS02

Receptor Information

>4tzd Chain A (length=232) Species: 28957 (Canavalia lineata) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTA
HIIYNSVGKRLSAVVSYPNGDSATVSYDVDLDNVLPEWVRVGLSASTGLY
KETNTILSWSFTSKLKETNALHFVFNQFSKDQKDLILQGDATTGTDGNLE
LTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFDATFTFLIKSSDSH
PADGIAFFISNIDSSIPSGSTGRLLGLFPDAN

Ligand information

>4tzd Chain H (length=2) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4tzd Crystal structure of Canavalia maritima lectin (ConM) complexed with interleukin 1 - beta primer
Resolution	3.2 Å
Binding residue (original residue number in PDB)	H51 I53 S110 H127 V129 D192
Binding residue (residue number reindexed from 1)	H51 I53 S110 H122 V124 D187

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005537	D-mannose binding
GO:0030246	carbohydrate binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:4tzd, PDBe:4tzd, PDBj:4tzd
PDBsum	4tzd
PubMed
UniProt	P81460\|CONA_CANLI Concanavalin-A

[Back to BioLiP]