Structure of PDB 4s0h Chain A Binding Site BS02

Receptor Information
>4s0h Chain A (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYIL
LMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQL
VSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKATAFCTHVFPETAFI
AVTSYQNHKITQLKIENNPFAKGFRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s0h Intermolecular Interactions of Cardiac Transcription Factors NKX2.5 and TBX5.
Resolution2.817 Å
Binding residue
(original residue number in PDB)		R81 R82 K159 Y217 T223 I227 N230 F232 F236
Binding residue
(residue number reindexed from 1)		R29 R30 K107 Y155 T161 I165 N168 F170 F174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4s0h, PDBe:4s0h, PDBj:4s0h
PDBsum4s0h
PubMed26926761
UniProtQ99593|TBX5_HUMAN T-box transcription factor TBX5 (Gene Name=TBX5)

[Back to BioLiP]