Structure of PDB 4rwp Chain A Binding Site BS02

Receptor Information

>4rwp Chain A (length=346) Species: 9823 (Sus scrofa)

MELRHTPARDLDKFIEDHLLPNTCFRTQVKEAIDIVCRFLKERCFQGTAD
PVRVSKVVKGGSSGKGTTLRGRSDADLVVFLTKLTSFEDQLRRRGEFIQE
IRRQLEACQREQKFKVTFEVQSPRRENPRALSFVLSSPQLQQEVEFDVLP
AFDALGQWTPGYKPNPEIYVQLIKECKSRGKEGEFSTCFTELQRDFLRNR
PTKLKSLIRLVKHWYQTCKKTHGNKLPPQYALELLTVYAWEQGSRKTDFS
TAQGFQTVLELVLKHQKLCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILD
PADPTGNVGGGDTHSWQRLAQEARVWLGYPCCKNLDGSLVGAWTML

Ligand information

>4rwp Chain C (length=18)

ucauaaaggucaaaagcc

..................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4rwp The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
• Resolution: 2.25 Å
• Binding residue (original residue number in PDB): D12 K13 E16 K30 D34 K56 V57 K59 Q157 R194 T202 K203 T247
• Binding residue (residue number reindexed from 1): D12 K13 E16 K30 D34 K56 V57 K59 Q157 R194 T202 K203 T247

Enzymatic activity

• Enzyme Commision number: 2.7.7.84: 2'-5' oligoadenylate synthase.

Gene Ontology

Molecular Function

• GO:0001730 2'-5'-oligoadenylate synthetase activity
• GO:0003723 RNA binding
• GO:0003725 double-stranded RNA binding
• GO:0005524 ATP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0045071 negative regulation of viral genome replication
• GO:0045087 innate immune response
• GO:0051607 defense response to virus
• GO:0060700 regulation of ribonuclease activity
• GO:1904188 negative regulation of transformation of host cell by virus

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:4rwp, PDBe:4rwp, PDBj:4rwp
• PDBsum: 4rwp
• PubMed: 25892109
• UniProt: Q29599|OAS1_PIG 2'-5'-oligoadenylate synthase 1 (Gene Name=OAS1)