Structure of PDB 4rve Chain A Binding Site BS02

Receptor Information
>4rve Chain A (length=240) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPI
INKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENE
KIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTY
NINELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVE
GKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rve The crystal structure of EcoRV endonuclease and of its complexes with cognate and non-cognate DNA fragments.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T37 S41 N70 K92 T93 T94 Y95 K119 N120 G182 S183 T186
Binding residue
(residue number reindexed from 1)		T36 S40 N69 K91 T92 T93 Y94 K118 N119 G181 S182 T185
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4rve, PDBe:4rve, PDBj:4rve
PDBsum4rve
PubMed8491171
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]