Structure of PDB 4rqi Chain A Binding Site BS02

Receptor Information

>4rqi Chain A (length=203) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLG
KEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTE
FTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLR
NDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKK
ALK

Ligand information

>4rqi Chain F (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ENRELELEAYRLGP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4rqi A higher-order entity formed by the flexible assembly of RAP1 with TRF2.
Resolution	2.4405 Å
Binding residue (original residue number in PDB)	R72 G74 D75
Binding residue (residue number reindexed from 1)	R30 G32 D33

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0042162	telomeric DNA binding
GO:0042803	protein homodimerization activity

	Biological Process
GO:0000723	telomere maintenance
GO:0031848	protection from non-homologous end joining at telomere

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4rqi, PDBe:4rqi, PDBj:4rqi
PDBsum	4rqi
PubMed	26748096
UniProt	Q15554\|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]