Structure of PDB 4rdm Chain A Binding Site BS02

Receptor Information
>4rdm Chain A (length=165) Species: 242231 (Neisseria gonorrhoeae FA 1090) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLENCLGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVFFGEGRRD
KRGFVKPRPWYEVELIVSKDITSQEGYPVLKSFTVITDDGWQFQCKTSGD
YSKNFRSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELR
STDNPDVWLLSFKGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rdm Crystal structure of the R-protein of the multisubunit ATP-dependent restriction endonuclease NgoAVII.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K212 E214 K216 S217 G224 E225 K230 R237 E243 I245 S247 K248 Y280 K282
Binding residue
(residue number reindexed from 1)		K33 E35 K37 S38 G45 E46 K51 R58 E64 I66 S68 K69 Y101 K103
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
External links