Structure of PDB 4r2q Chain A Binding Site BS02

Receptor Information
>4r2q Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHL
KTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r2q Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
Resolution1.54 Å
Binding residue
(original residue number in PDB)
D368 K399 S425 D426
Binding residue
(residue number reindexed from 1)
D20 K51 S77 D78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4r2q, PDBe:4r2q, PDBj:4r2q
PDBsum4r2q
PubMed25258363
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]