Structure of PDB 4qr9 Chain A Binding Site BS02

Receptor Information
>4qr9 Chain A (length=75) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAK
EKGKFEDMAKADKARYEREMKTYIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qr9 Two high-mobility group box domains act together to underwind and kink DNA.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K7 S13 Y15 F37 S38 S41 K42 S45 W48
Binding residue
(residue number reindexed from 1)		K3 S9 Y11 F33 S34 S37 K38 S41 W44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4qr9, PDBe:4qr9, PDBj:4qr9
PDBsum4qr9
PubMed26143914
UniProtP63159|HMGB1_RAT High mobility group protein B1 (Gene Name=Hmgb1)

[Back to BioLiP]