Structure of PDB 4qlc Chain A Binding Site BS02

Receptor Information
>4qlc Chain A (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>4qlc Chain J (length=166) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acttacatgcacaggatgtatatatctgacacgtgcctggagactaggga
gtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgttta
agcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggat
tctccagggcggccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qlc Structural Mechanisms of Nucleosome Recognition by Linker Histones.
Resolution3.503 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 G7 V9 A10 R12 R26 K27 L28 P29 R32
Binding affinityPDBbind-CN: Kd=0.35uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qlc, PDBe:4qlc, PDBj:4qlc
PDBsum4qlc
PubMed26212454
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]