Structure of PDB 4pzi Chain A Binding Site BS02

Receptor Information
>4pzi Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHGKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKC
DKIEARKMERL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pzi DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		R962 M963 R965 K997 Q998 C999
Binding residue
(residue number reindexed from 1)		R7 M8 R10 K42 Q43 C44
Enzymatic activity
Enzyme Commision number 2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:4pzi, PDBe:4pzi, PDBj:4pzi
PDBsum4pzi
PubMed29276034
UniProtQ9UMN6|KMT2B_HUMAN Histone-lysine N-methyltransferase 2B (Gene Name=KMT2B)

[Back to BioLiP]