Structure of PDB 4py5 Chain A Binding Site BS02

Receptor Information
>4py5 Chain A (length=267) Species: 648996 (Thermovibrio ammonificans HB-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKLSSSEKEKLLKKLKALGAKEEKPPEHAQYRLRLNDAILTVYKSGSVV
YGGKGREKLKELVAETVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEK
CLKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSK
FKNINRLLEAVYREIVSDLCEKFSPKVVVVDKFSNRAEEVLKDVVKGARL
EVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTGLAELLK
KTPKELHEKLFKLHFSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4py5 Crystal structure of RNase H3-substrate complex reveals parallel evolution of RNA/DNA hybrid recognition.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S0 H28 Y43 S45 S47 V49 K82 G83 K110 Y147 N152 I153 N241 F264 V266
Binding residue
(residue number reindexed from 1)		S1 H29 Y44 S46 S48 V50 K83 G84 K111 Y148 N153 I154 N242 F265 V267
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006298 mismatch repair
GO:0006401 RNA catabolic process
GO:0016070 RNA metabolic process
GO:0043137 DNA replication, removal of RNA primer
Cellular Component
GO:0005737 cytoplasm
GO:0032299 ribonuclease H2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4py5, PDBe:4py5, PDBj:4py5
PDBsum4py5
PubMed25016521
UniProtE8T217

[Back to BioLiP]