Structure of PDB 4pme Chain A Binding Site BS02

Receptor Information

>4pme Chain A (length=117) Species: 9606 (Homo sapiens)

KCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGL
TTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA
ALLSPYSYSTTAVVTNP

Ligand information

• Ligand ID: EDO
• InChI: InChI=1S/C2H6O2/c3-1-2-4/h3-4H,1-2H2
• InChIKey: LYCAIKOWRPUZTN-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341: OCCO
  OpenEye OEToolkits 1.5.0: C(CO)O
• Formula: C2 H6 O2
• Name: 1,2-ETHANEDIOL;
  ETHYLENE GLYCOL
• ChEMBL: CHEMBL457299
• ZINC: ZINC000005224354
• PDB chain: 4pme Chain A Residue 203

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4pme Transthyretin complexes with curcumin and bromo-estradiol: evaluation of solubilizing multicomponent mixtures.
• Resolution: 1.264 Å
• Binding residue (original residue number in PDB): L110 S112 S115 Y116
• Binding residue (residue number reindexed from 1): L102 S104 S107 Y108
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4pme, PDBe:4pme, PDBj:4pme
• PDBsum: 4pme
• PubMed: 25224922
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)