Structure of PDB 4p4m Chain A Binding Site BS02

Receptor Information
>4p4m Chain A (length=270) Species: 5671 (Leishmania infantum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPKLKAIQELTQVHGFGPRAAAALFDREGIFTVDELLQKADSIPSLTDQQ
RVGIKYFYDINEKIPMQESVLHENYLREKCMEVLGKDFSILICGSYRRRH
PFSGDVDAILSRTLDAPPLSEPVAATGVLGHFVEFLESLKYLEATMAQGP
LKYMGMGRLPPRINTKVYKARRVDIRLIETKSVPTAMLTFTGSKNFNVIM
RQAAISKGYLLNEYGLFKLGTPEEARGKNAGEELGVPKDELEDKRVEVRS
EQDVFDVLGMPYAKPENRDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p4m Structures of the Leishmania infantum polymerase beta.
Resolution1.9185 Å
Binding residue
(original residue number in PDB)		A236 Q237 G238 P239 L240 K241 R273 V295 R298 Q299 I302 L307 E310 Y311 N335 A336 E338
Binding residue
(residue number reindexed from 1)		A147 Q148 G149 P150 L151 K152 R176 V198 R201 Q202 I205 L210 E213 Y214 N229 A230 E232
Enzymatic activity
Catalytic site (original residue number in PDB) D271
Catalytic site (residue number reindexed from 1) D174
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0016772 transferase activity, transferring phosphorus-containing groups
GO:0034061 DNA polymerase activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4p4m, PDBe:4p4m, PDBj:4p4m
PDBsum4p4m
PubMed24666693
UniProtQ9U6N3

[Back to BioLiP]