Structure of PDB 4on0 Chain A Binding Site BS02

Receptor Information
>4on0 Chain A (length=97) Species: 380 (Sinorhizobium fredii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLS
QSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4on0 Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
N28 R31 S57 Q61 H62 K65
Binding residue
(residue number reindexed from 1)
N23 R26 S52 Q56 H57 K60
Binding affinityPDBbind-CN: Kd=0.36uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4on0, PDBe:4on0, PDBj:4on0
PDBsum4on0
PubMed24733893
UniProtQ83TD2

[Back to BioLiP]