Structure of PDB 4ofe Chain A Binding Site BS02

Receptor Information
>4ofe Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WTPPRSPFNLVQETLFHDPWKLLIATIFLNKTSGKMAIPVLWKFLEKYPS
AEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGI
GKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ofe Structure of R468K/D560N MBD4 bound to G:T mispair DNA
Resolution2.15 Å
Binding residue
(original residue number in PDB)		K468 K472 M473 P505 G507 L508 Y509 D510 L511
Binding residue
(residue number reindexed from 1)		K31 K35 M36 P68 G70 L71 Y72 D73 L74
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ofe, PDBe:4ofe, PDBj:4ofe
PDBsum4ofe
PubMed
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]