Structure of PDB 4nw3 Chain A Binding Site BS02

Receptor Information
>4nw3 Chain A (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQW
M
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nw3 DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution2.82 Å
Binding residue
(original residue number in PDB)
I1184 K1185 K1186
Binding residue
(residue number reindexed from 1)
I35 K36 K37
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:4nw3, PDBe:4nw3, PDBj:4nw3
PDBsum4nw3
PubMed29276034
UniProtQ03164|KMT2A_HUMAN Histone-lysine N-methyltransferase 2A (Gene Name=KMT2A)

[Back to BioLiP]