Structure of PDB 4mhg Chain A Binding Site BS02

Receptor Information
>4mhg Chain A (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTN
MTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mhg Steric Mechanism of Auto-Inhibitory Regulation of Specific and Non-Specific DNA Binding by the ETS Transcriptional Repressor ETV6.
Resolution2.199 Å
Binding residue
(original residue number in PDB)		L336 W376 K380 R382 M385 K389 R392 H396 Y397
Binding residue
(residue number reindexed from 1)		L2 W42 K46 R48 M51 K55 R58 H62 Y63
Binding affinityPDBbind-CN: Kd=10uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4mhg, PDBe:4mhg, PDBj:4mhg
PDBsum4mhg
PubMed24333486
UniProtP97360|ETV6_MOUSE Transcription factor ETV6 (Gene Name=Etv6)

[Back to BioLiP]