Structure of PDB 4m9e Chain A Binding Site BS02

Receptor Information
>4m9e Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELT
RHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m9e Structural basis for Klf4 recognition of methylated DNA.
Resolution1.851 Å
Binding residue
(original residue number in PDB)
K413 S415 Y430 S472 D473
Binding residue
(residue number reindexed from 1)
K15 S17 Y32 S74 D75
Binding affinityPDBbind-CN: Kd=30nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4m9e, PDBe:4m9e, PDBj:4m9e
PDBsum4m9e
PubMed24520114
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]