Structure of PDB 4m6f Chain A Binding Site BS02

Receptor Information
>4m6f Chain A (length=188) Species: 10677 (Muvirus mu) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIGYVRVSTNDQNTDLQRNALVCAGCEQIFEDKLSGTRTDRPGLKRALKR
LQKGDTLVVWKLDRLGRSMKHLISLVGELRERGINFRSLTDSIDTSSPMG
RFFFHVMGALAEVERELIIERTMAGLAAARNKGRIGGRPPKLTKAEQEQA
GRLLAQGIPRKQVALIYDVALSTLYKKHPAKRAHIEND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m6f Exploiting large non-isomorphous differences for phase determination of a G-segment invertase-DNA complex.
Resolution4.99 Å
Binding residue
(original residue number in PDB)		R122 T123 G126 L127 A130 R135 G137 G138 R139 P140 S173 Y176 A181 K182 I186 E187 N188 D189
Binding residue
(residue number reindexed from 1)		R121 T122 G125 L126 A129 R134 G136 G137 R138 P139 S172 Y175 A180 K181 I185 E186 N187 D188
Enzymatic activity
Enzyme Commision number 3.1.22.-
6.5.1.-
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
GO:0016787 hydrolase activity
GO:0016874 ligase activity
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration
GO:0046718 symbiont entry into host cell
GO:0098678 viral tropism switching
Cellular Component
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4m6f, PDBe:4m6f, PDBj:4m6f
PDBsum4m6f
PubMed24598738
UniProtP03015|GIN_BPMU Serine recombinase gin (Gene Name=gin)

[Back to BioLiP]