Structure of PDB 4m6b Chain A Binding Site BS02

Receptor Information
>4m6b Chain A (length=185) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAY
NKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSAR
AGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNA
AKDLKVKRITPRHLQLAIRGDDELDSLIRATIASG
Ligand information
>4m6b Chain F (length=23) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVGLSALFDLDLDDSEDFTVNSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m6b The Catalytic Subunit of the SWR1 Remodeler Is a Histone Chaperone for the H2A.Z-H2B Dimer.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		L190 K191 R198
Binding residue
(residue number reindexed from 1)		L154 K155 R162
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4m6b, PDBe:4m6b, PDBj:4m6b
PDBsum4m6b
PubMed24507717
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1);
Q12692

[Back to BioLiP]