Structure of PDB 4m2z Chain A Binding Site BS02

Receptor Information

>4m2z Chain A (length=220) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFI
VDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKIN
ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKD
YKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKS
KKEAEQRAAEELIKLLEESE

Ligand information

>4m2z Chain D (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaggucauucgcaagaguggccuugcg

<<<<<<<<<<....>>>>>>>>>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4m2z RNase III: Genetics and Function; Structure and Mechanism.
Resolution	2.85 Å
Binding residue (original residue number in PDB)	D44 E64 S68 A72 I75 S76 E77 D151 K153 T154 Q157 E158 Q161 K165 R167 K203
Binding residue (residue number reindexed from 1)	D43 E63 S67 A71 I74 S75 E76 D150 K152 T153 Q156 E157 Q160 K164 R166 K202

Enzymatic activity

Enzyme Commision number

3.1.26.3: ribonuclease III.

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003725	double-stranded RNA binding
GO:0004519	endonuclease activity
GO:0004525	ribonuclease III activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006364	rRNA processing
GO:0006396	RNA processing
GO:0006397	mRNA processing
GO:0008033	tRNA processing
GO:0010468	regulation of gene expression

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4m2z, PDBe:4m2z, PDBj:4m2z
PDBsum	4m2z
PubMed	24274754
UniProt	O67082\|RNC_AQUAE Ribonuclease 3 (Gene Name=rnc)

[Back to BioLiP]