Structure of PDB 4lyu Chain A Binding Site BS02

Receptor Information

>4lyu Chain A (length=171) Species: 8400 (Aquarana catesbeiana)

VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEF
FKEHSHEEREHAEKFMKYQNKRGGRVVLQDIKKPERDEWGNTLEAMQAAL
QLEKTVNQALLDLHKLATDKVDPHLCDFLESEYLEEQVKDIKRIGDFITN
LKRLGLPENGMGEYLFDKHSV

Ligand information

• Ligand ID: FE2
• InChI: InChI=1S/Fe/q+2
• InChIKey: CWYNVVGOOAEACU-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Fe+2]
  CACTVS 3.341: [Fe++]
• Formula: Fe
• Name: FE (II) ION
• DrugBank: DB14510
• PDB chain: 4lyu Chain A Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4lyu Time-lapse anomalous X-ray diffraction shows how Fe(2+) substrate ions move through ferritin protein nanocages to oxidoreductase sites.
• Resolution: 1.75 Å
• Binding residue (original residue number in PDB): H54 E57 E58 E103 D140
• Binding residue (residue number reindexed from 1): H54 E57 E58 E103 D140
• Annotation score: 5

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0008198 ferrous iron binding
• GO:0008199 ferric iron binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4lyu, PDBe:4lyu, PDBj:4lyu
• PDBsum: 4lyu
• PubMed: 25849404
• UniProt: P07798|FRI2_AQUCT Ferritin, middle subunit