Structure of PDB 4lvm Chain A Binding Site BS02

Receptor Information
>4lvm Chain A (length=192) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYMVARMQKMKAGNLGGAFKHNERVKDINPSRSHLNYELTDRDRSVSYEK
QIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETA
KNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREEL
KHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMADM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lvm Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y3 V5 A6 R7 M8 K10 K12 H22 R74 D76 V78 W83 E129 S130 K145 S147 K149 D153 R154 L157 Q161 R177 G178 K179 N181 S182 A184 H186 K187 F192
Binding residue
(residue number reindexed from 1)		Y2 V4 A5 R6 M7 K9 K11 H21 R67 D69 V71 W76 E122 S123 K138 S140 K142 D146 R147 L150 Q154 R170 G171 K172 N174 S175 A177 H179 K180 F185
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lvm, PDBe:4lvm, PDBj:4lvm
PDBsum4lvm
PubMed28739894
UniProtP13925|PRE_STRAG Plasmid recombination enzyme (Gene Name=pre)

[Back to BioLiP]