Structure of PDB 4lvk Chain A Binding Site BS02

Receptor Information
>4lvk Chain A (length=191) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSY
EKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFE
TAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDRE
ELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lvk Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
Resolution2.37 Å
Binding residue
(original residue number in PDB)
Y3 V5 R7 M8 K10 K12 R74 D76 V78 H126 E129 S130 T131 H135 K145 K149 D153 R154 L157 K158 Q161 R177 G178 K179 N181 S182 A184 H186 K187 V189 F192 K193 M196
Binding residue
(residue number reindexed from 1)
Y2 V4 R6 M7 K9 K11 R69 D71 V73 H121 E124 S125 T126 H130 K140 K144 D148 R149 L152 K153 Q156 R172 G173 K174 N176 S177 A179 H181 K182 V184 F187 K188 M191
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4lvk, PDBe:4lvk, PDBj:4lvk
PDBsum4lvk
PubMed28739894
UniProtP13925|PRE_STRAG Plasmid recombination enzyme (Gene Name=pre)

[Back to BioLiP]