Structure of PDB 4lvj Chain A Binding Site BS02

Receptor Information
>4lvj Chain A (length=192) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYMVARMQKMKAGNLGGAFKHNERVFSNKDINPSRSHLNYELTDRDRSVS
YEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFF
ETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDR
EELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lvj Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
Resolution2.17 Å
Binding residue
(original residue number in PDB)		Y3 V5 R7 M8 K10 K12 H22 R74 D76 V78 W83 I84 T86 E129 S130 T131 H133 H135 K149 D153 R154 L157 K158 Q161 R177 G178 K179 N181 S182 A184 H186 K187 V189 F192 K193 M196
Binding residue
(residue number reindexed from 1)		Y2 V4 R6 M7 K9 K11 H21 R70 D72 V74 W79 I80 T82 E125 S126 T127 H129 H131 K145 D149 R150 L153 K154 Q157 R173 G174 K175 N177 S178 A180 H182 K183 V185 F188 K189 M192
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lvj, PDBe:4lvj, PDBj:4lvj
PDBsum4lvj
PubMed28739894
UniProtP13925|PRE_STRAG Plasmid recombination enzyme (Gene Name=pre)

[Back to BioLiP]