Structure of PDB 4lln Chain A Binding Site BS02

Receptor Information
>4lln Chain A (length=137) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQND
IAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVE
AFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lln Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
Resolution2.842 Å
Binding residue
(original residue number in PDB)		T30 E32 Q33 R59 T60 P62 T63 L67 N70 D85 T86 R87
Binding residue
(residue number reindexed from 1)		T28 E30 Q31 R57 T58 P60 T61 L65 N68 D83 T84 R85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lln, PDBe:4lln, PDBj:4lln
PDBsum4lln
PubMed24293644
UniProtQ5Y812

[Back to BioLiP]