Structure of PDB 4lj0 Chain A Binding Site BS02

Receptor Information
>4lj0 Chain A (length=65) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQDCKYWPNCANPLCAFRHPTMPPCRNGGECKVPGCKFTHLKTPCKFRPC
TNRSCPFLHEEGQRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lj0 Structural basis for the molecular recognition of polyadenosine RNA by Nab2 Zn fingers.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		N410 A412 C446 K447 F448 C451 T452 N453 F458
Binding residue
(residue number reindexed from 1)		N9 A11 C45 K46 F47 C50 T51 N52 F57
Binding affinityPDBbind-CN: Kd=0.5uM
Enzymatic activity
Enzyme Commision number ?
External links