Structure of PDB 4lg7 Chain A Binding Site BS02

Receptor Information
>4lg7 Chain A (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNG
ETSLKPEDFDFTV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lg7 Crystal structure MBD4 MBD domain in complex with methylated CpG DNA
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R97 L98 F99 G100 K101 T102
Binding residue
(residue number reindexed from 1)		R15 L16 F17 G18 K19 T20
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4lg7, PDBe:4lg7, PDBj:4lg7
PDBsum4lg7
PubMed
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]