Structure of PDB 4l18 Chain A Binding Site BS02

Receptor Information
>4l18 Chain A (length=142) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTL
VTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITV
FTNPPQVATYHRAIKITVDGPREPRPGSLSFSERLSELEQLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l18 Structural basis of Ets1 activation by Runx1.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R80 R135 R174 R177
Binding residue
(residue number reindexed from 1)		R28 R83 R122 R125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4l18, PDBe:4l18, PDBj:4l18
PDBsum4l18
PubMed24646888
UniProtQ03347|RUNX1_MOUSE Runt-related transcription factor 1 (Gene Name=Runx1)

[Back to BioLiP]