Structure of PDB 4l0z Chain A Binding Site BS02

Receptor Information
>4l0z Chain A (length=147) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLV
TVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRGSLSFSERLSELEQLRRTAMRVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l0z Structural basis of Ets1 activation by Runx1.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R80 R135 R142 R174 R177
Binding residue
(residue number reindexed from 1)		R27 R82 R89 R121 R124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4l0z, PDBe:4l0z, PDBj:4l0z
PDBsum4l0z
PubMed24646888
UniProtQ03347|RUNX1_MOUSE Runt-related transcription factor 1 (Gene Name=Runx1)

[Back to BioLiP]