Structure of PDB 4kax Chain A Binding Site BS02

Receptor Information
>4kax Chain A (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNV
WDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDRE
MRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDG
LYEGLTWLTSNYN
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain4kax Chain A Residue 202 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4kax Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		T27 T44
Binding residue
(residue number reindexed from 1)		T16 T33
Annotation score1
Enzymatic activity
Catalytic site (original residue number in PDB) L67
Catalytic site (residue number reindexed from 1) L56
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0031996 thioesterase binding
GO:0035591 signaling adaptor activity
Biological Process
GO:0001889 liver development
GO:0006886 intracellular protein transport
GO:0007155 cell adhesion
GO:0007399 nervous system development
GO:0010975 regulation of neuron projection development
GO:0010976 positive regulation of neuron projection development
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0030154 cell differentiation
GO:0030838 positive regulation of actin filament polymerization
GO:0030866 cortical actin cytoskeleton organization
GO:0032456 endocytic recycling
GO:0034394 protein localization to cell surface
GO:0035020 regulation of Rac protein signal transduction
GO:0036010 protein localization to endosome
GO:0048261 negative regulation of receptor-mediated endocytosis
GO:0048488 synaptic vesicle endocytosis
GO:0050714 positive regulation of protein secretion
GO:0051301 cell division
GO:0051489 regulation of filopodium assembly
GO:0051549 positive regulation of keratinocyte migration
GO:0060998 regulation of dendritic spine development
GO:0072659 protein localization to plasma membrane
GO:0090162 establishment of epithelial cell polarity
GO:0097178 ruffle assembly
GO:0097284 hepatocyte apoptotic process
GO:0099562 maintenance of postsynaptic density structure
GO:0120183 positive regulation of focal adhesion disassembly
GO:1902217 erythrocyte apoptotic process
GO:1903078 positive regulation of protein localization to plasma membrane
GO:1903438 positive regulation of mitotic cytokinetic process
GO:1905345 protein localization to cleavage furrow
GO:1905606 regulation of presynapse assembly
GO:1990090 cellular response to nerve growth factor stimulus
GO:2000009 negative regulation of protein localization to cell surface
GO:2000171 negative regulation of dendrite development
Cellular Component
GO:0001726 ruffle
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0005938 cell cortex
GO:0016020 membrane
GO:0030139 endocytic vesicle
GO:0030496 midbody
GO:0031527 filopodium membrane
GO:0031901 early endosome membrane
GO:0032154 cleavage furrow
GO:0042995 cell projection
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0090543 Flemming body
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kax, PDBe:4kax, PDBj:4kax
PDBsum4kax
PubMed23940353
UniProtP62330|ARF6_HUMAN ADP-ribosylation factor 6 (Gene Name=ARF6)

[Back to BioLiP]