Structure of PDB 4k1g Chain A Binding Site BS02

Receptor Information

>4k1g Chain A (length=283) Species: 83333 (Escherichia coli K-12)

MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTID
EFKAACEKYHYTSAQILPADSYLINLGHPVTEALEKSRDAFIDEMQRCEQ
LGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQ
GSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTF
ADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQD
DRFDGIPLILETINPDIWAEEIAWLKAQQTEKA

Ligand information

>4k1g Chain F (length=15)

cgtcgtcgtggacgc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4k1g Insight into mechanisms of 3'-5' exonuclease activity and removal of bulky 8,5'-cyclopurine adducts by apurinic/apyrimidinic endonucleases.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): R37 Q38 W39 Y72 L73 Q150 G151 S152
• Binding residue (residue number reindexed from 1): R37 Q38 W39 Y72 L73 Q150 G151 S152

Enzymatic activity

• Catalytic site (original residue number in PDB): R37 A69 Y72 H109 E145 D179 H182 H216 D229 H231 E261
• Catalytic site (residue number reindexed from 1): R37 A69 Y72 H109 E145 D179 H182 H216 D229 H231 E261
• Enzyme Commision number: 3.1.21.2: deoxyribonuclease IV.

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
• GO:0004519 endonuclease activity
• GO:0008081 phosphoric diester hydrolase activity
• GO:0008270 zinc ion binding
• GO:0008296 3'-5'-DNA exonuclease activity
• GO:0008833 deoxyribonuclease IV (phage-T4-induced) activity
• GO:0016791 phosphatase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4k1g, PDBe:4k1g, PDBj:4k1g
• PDBsum: 4k1g
• PubMed: 23898172
• UniProt: P0A6C1|END4_ECOLI Endonuclease 4 (Gene Name=nfo)