Structure of PDB 4jwe Chain A Binding Site BS02

Receptor Information
>4jwe Chain A (length=213) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jwe Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
Resolution1.95 Å
Binding residue
(original residue number in PDB)
T403 M404 Q424 V425 F426 S427 T428 A429 E430 Q433 A435 T437 N458
Binding residue
(residue number reindexed from 1)
T15 M16 Q36 V37 F38 S39 T40 A41 E42 Q45 A47 T49 N70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:4jwe, PDBe:4jwe, PDBj:4jwe
PDBsum4jwe
PubMed24164259
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]