Structure of PDB 4jnx Chain A Binding Site BS02

Receptor Information
>4jnx Chain A (length=124) Species: 12145 (Tomato bushy stunt virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLR
YDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSG
GSRTLQHLCEMAIRSKQELLQLAP
Ligand information
>4jnx Chain G (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcugcugcugcugcugcugc
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jnx Procrustean bed of RNA silencing suppression
Resolution1.95 Å
Binding residue
(original residue number in PDB)		P15 W17 W20 K38 Y51 Q85 I86 G87 G103 G104
Binding residue
(residue number reindexed from 1)		P14 W16 W19 K35 Y48 Q82 I83 G84 G100 G101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:4jnx, PDBe:4jnx, PDBj:4jnx
PDBsum4jnx
PubMed
UniProtP69517|P19_TBSVK RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]