Structure of PDB 4jgc Chain A Binding Site BS02

Receptor Information
>4jgc Chain A (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFNGVSEAELLTKTLPDILTFNLDIVIIGIAPGLMAAYKGHHYPGPGNHF
WKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFR
EGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKI
PDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jgc Activity and crystal structure of human thymine DNA glycosylase mutant N140A with 5-carboxylcytosine DNA at low pH.
Resolution2.582 Å
Binding residue
(original residue number in PDB)		A140 N157 S200 G231 K232 C233 F252 S271 S273 A274 R275 C276 A277 Q278
Binding residue
(residue number reindexed from 1)		A31 N48 S91 G122 K123 C124 F143 S162 S164 A165 R166 C167 A168 Q169
Enzymatic activity
Catalytic site (original residue number in PDB) A140 H151
Catalytic site (residue number reindexed from 1) A31 H42
Enzyme Commision number 3.2.2.29: thymine-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0000700 mismatch base pair DNA N-glycosylase activity
Biological Process
GO:0006285 base-excision repair, AP site formation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4jgc, PDBe:4jgc, PDBj:4jgc
PDBsum4jgc
PubMed23680598
UniProtQ13569|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase (Gene Name=TDG)

[Back to BioLiP]