Structure of PDB 4jcx Chain A Binding Site BS02

Receptor Information

>4jcx Chain A (length=94) Species: 315237 (Citrobacter sp. RFL231) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMA
NRLAKVLKIPVSYLYTPEDDLAQIILTWNELNEQERKRINFYIR

Ligand information

>4jcx Chain D (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttactaagttttccttagtgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4jcx Structural analysis of DNA binding by C.Csp231I, a member of a novel class of R-M controller proteins regulating gene expression.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	A33 R34 Q37 Y38 H43 A44
Binding residue (residue number reindexed from 1)	A33 R34 Q37 Y38 H43 A44

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:4jcx, PDBe:4jcx, PDBj:4jcx
PDBsum	4jcx
PubMed	25664751
UniProt	Q32WH4

[Back to BioLiP]