Structure of PDB 4j2l Chain A Binding Site BS02

Receptor Information
>4j2l Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVER
IEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQ
LFDLPCSKLSVGDVCISLTLK
Ligand information
>4j2l Chain D (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MFVWTNVEPRSVAVFPWHSLVPFLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j2l Structural basis of protein complex formation and reconfiguration by polyglutamine disease protein Ataxin-1 and Capicua
Resolution3.15 Å
Binding residue
(original residue number in PDB)		Y574 F632 V641 S642 Y649
Binding residue
(residue number reindexed from 1)		Y6 F64 V73 S74 Y81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4j2l, PDBe:4j2l, PDBj:4j2l
PDBsum4j2l
PubMed23512657
UniProtP54253|ATX1_HUMAN Ataxin-1 (Gene Name=ATXN1)

[Back to BioLiP]