Structure of PDB 4j00 Chain A Binding Site BS02

Receptor Information

>4j00 Chain A (length=297) Species: 98439 (Fischerella thermalis PCC 7521) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SNDVDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIY
MTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPR
YLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLIT
SFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDS
PWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRV
LEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE

Ligand information

>4j00 Chain D (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tggtgaggggttaaacccctcacc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4j00 Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
Resolution	3.004 Å
Binding residue (original residue number in PDB)	H35 N60 L61 R62 S179 A181
Binding residue (residue number reindexed from 1)	H34 N59 L60 R61 S178 A180

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004252	serine-type endopeptidase activity
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis
GO:0043158	heterocyst development

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4j00, PDBe:4j00, PDBj:4j00
PDBsum	4j00
PubMed	23610410
UniProt	Q2ACK9

[Back to BioLiP]