Structure of PDB 4ht6 Chain A Binding Site BS02

Receptor Information
>4ht6 Chain A (length=86) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNT
WHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA
Ligand information
>4ht6 Chain D (length=11) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ITYDKGIQTDQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ht6 The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E38 R39
Binding residue
(residue number reindexed from 1)		E32 R33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008574 plus-end-directed microtubule motor activity
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0006913 nucleocytoplasmic transport
GO:0007017 microtubule-based process
GO:0015031 protein transport
GO:0030473 nuclear migration along microtubule
GO:0040001 establishment of mitotic spindle localization
GO:0051028 mRNA transport
GO:0051292 nuclear pore complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005881 cytoplasmic microtubule
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex
GO:0034399 nuclear periphery
GO:1990429 peroxisomal importomer complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ht6, PDBe:4ht6, PDBj:4ht6
PDBsum4ht6
PubMed23761070
UniProtQ02647|DYL1_YEAST Dynein light chain 1, cytoplasmic (Gene Name=DYN2)

[Back to BioLiP]