Structure of PDB 4h8k Chain A Binding Site BS02

Receptor Information
>4h8k Chain A (length=138) Species: 155900 (uncultured organism) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIIIYTDGGARGNPGPAGIGVVITDEKGNTLHESSAYIGETTNNVAEYEA
LIRALEDLQMFGDKLVDMEVEVRMNSELIVRQMQGVYKVKEPTLKEKFAK
IAHIKMERVPNLVFVHIPREKNARADELVNEAIDKALS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h8k Crystal structure of metagenome-derived LC11-RNase H1 in complex with RNA/DNA hybrid
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N15 T44 N45 N46 L80 Q84 Y89 K90 V91 K92 L96
Binding residue
(residue number reindexed from 1)		N13 T42 N43 N44 L78 Q82 Y87 K88 V89 K90 L94
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0016787 hydrolase activity

View graph for
Molecular Function
External links
PDB RCSB:4h8k, PDBe:4h8k, PDBj:4h8k
PDBsum4h8k
PubMed23500886
UniProtE0X767

[Back to BioLiP]