Structure of PDB 4gvd Chain A Binding Site BS02

Receptor Information

>4gvd Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAMGKVTHSIHIEKADTYGFSLSSVEEIRRLYVNSVKETGLASKKGLKAG
DEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPE

Ligand information

>4gvd Chain D (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TKQEEFYA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4gvd The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
Resolution	1.85 Å
Binding residue (original residue number in PDB)	T857 Y858 G859 F860 S861 L862 S863 S864 V865 E866
Binding residue (residue number reindexed from 1)	T17 Y18 G19 F20 S21 L22 S23 S24 V25 E26

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005085	guanyl-nucleotide exchange factor activity

	Biological Process
GO:0007264	small GTPase-mediated signal transduction
GO:0090630	activation of GTPase activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4gvd, PDBe:4gvd, PDBj:4gvd
PDBsum	4gvd
PubMed	23395182
UniProt	Q13009\|TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 (Gene Name=TIAM1)

[Back to BioLiP]